SCOP 1.73: Domain d1yqcb1: 1yqc B:1-160

Lineage for d1yqcb1 (1yqc B:1-160)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (3 species)

7. Species Escherichia coli [TaxId:562] [141604] (1 PDB entry)

8. Domain d1yqcb1: 1yqc B:1-160 [123878]
   automatically matched to 1YQC A:1-160
   complexed with glv

Details for d1yqcb1

PDB Entry: 1yqc, 1.71 Å

PDB Description: crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7

PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOP Domain Sequences for d1yqcb1:

Sequence; same for both SEQRES and ATOM records:

>d1yqcb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Timeline for d1yqcb1:

• d1yqcb1 is new in SCOP 1.73
  
• d1yqcb1 appears in SCOP 1.75
  
• d1yqcb1 appears in the current release, SCOPe 2.08, called d1yqcb_