Lineage for d1yqcb1 (1yqc B:1-160)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677600Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
    Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold
  6. 677601Protein Ureidoglycolate hydrolase AllA [117313] (3 species)
  7. 677602Species Escherichia coli [TaxId:562] [141604] (1 PDB entry)
  8. 677604Domain d1yqcb1: 1yqc B:1-160 [123878]
    automatically matched to 1YQC A:1-160
    complexed with glv

Details for d1yqcb1

PDB Entry: 1yqc (more details), 1.71 Å

PDB Description: crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7
PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOP Domain Sequences for d1yqcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqcb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

SCOP Domain Coordinates for d1yqcb1:

Click to download the PDB-style file with coordinates for d1yqcb1.
(The format of our PDB-style files is described here.)

Timeline for d1yqcb1: