Lineage for d1yqcb_ (1yqc B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814942Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
    Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold
  6. 2814943Protein Ureidoglycolate hydrolase AllA [117313] (4 species)
  7. 2814944Species Escherichia coli [TaxId:562] [141604] (1 PDB entry)
    Uniprot P63486 1-160
  8. 2814946Domain d1yqcb_: 1yqc B: [123878]
    automated match to d1xsra_
    complexed with glv

Details for d1yqcb_

PDB Entry: 1yqc (more details), 1.71 Å

PDB Description: crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7
PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1yqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqcb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

SCOPe Domain Coordinates for d1yqcb_:

Click to download the PDB-style file with coordinates for d1yqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1yqcb_: