SCOPe 2.08: Domain d1yqca1: 1yqc A:1-160

Lineage for d1yqca1 (1yqc A:1-160)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (4 species)

7. Species Escherichia coli [TaxId:562] [141604] (1 PDB entry)
   Uniprot P63486 1-160

8. Domain d1yqca1: 1yqc A:1-160 [123877]
   complexed with glv

Details for d1yqca1

PDB Entry: 1yqc, 1.71 Å

PDB Description: crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7

PDB Compounds: (A:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1yqca1:

Sequence; same for both SEQRES and ATOM records:

>d1yqca1 b.82.1.14 (A:1-160) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Timeline for d1yqca1:

• d1yqca1 first appeared in SCOP 1.73
  
• d1yqca1 appears in SCOPe 2.07