Lineage for d1yqba1 (1yqb A:15-98)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717210Protein Ubiquilin-3 [142946] (1 species)
  7. 717211Species Human (Homo sapiens) [TaxId:9606] [142947] (2 PDB entries)
  8. 717212Domain d1yqba1: 1yqb A:15-98 [123876]

Details for d1yqba1

PDB Entry: 1yqb (more details), 2 Å

PDB Description: Human Ubiquilin 3
PDB Compounds: (A:) Ubiquilin 3

SCOP Domain Sequences for d1yqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}
prgsphlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpdqlvlifagkilkdpd
slaqcgvrdgltvhlvikrqhram

SCOP Domain Coordinates for d1yqba1:

Click to download the PDB-style file with coordinates for d1yqba1.
(The format of our PDB-style files is described here.)

Timeline for d1yqba1: