![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquilin-3 [142946] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142947] (2 PDB entries) Uniprot Q9H347 11-104! Uniprot Q9H347 15-98 |
![]() | Domain d1yqba1: 1yqb A:19-98 [123876] Other proteins in same PDB: d1yqba2 |
PDB Entry: 1yqb (more details), 2 Å
SCOPe Domain Sequences for d1yqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqba1 d.15.1.1 (A:19-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} phlikvtvktpkdkedfsvtdtctiqqlkeeisqrfkahpdqlvlifagkilkdpdslaq cgvrdgltvhlvikrqhram
Timeline for d1yqba1: