SCOPe 2.06: Domain d1yqaa1: 1yqa A:171-257

Lineage for d1yqaa1 (1yqa A:171-257)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.13: Linker histone H1/H5 [46827] (3 proteins)
   automatically mapped to Pfam PF00538

6. Protein Histone H1 homologue Hho1p [101037] (1 species)
   duplication: contains two similar globular domains

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries)

8. Domain d1yqaa1: 1yqa A:171-257 [123875]

Details for d1yqaa1

PDB Entry: 1yqa

PDB Description: engineering the structural stability and functional properties of the gi domain into the intrinsically unfolded gii domain of the yeast linker histone hho1p

PDB Compounds: (A:) Histone H1

SCOPe Domain Sequences for d1yqaa1:

Sequence; same for both SEQRES and ATOM records:

>d1yqaa1 a.4.5.13 (A:171-257) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kasspssltykemilksmpqlndgkgssrivlkkyvkdtypivgsasnfdylfnsaikkc
vengelvqpkgpsgiiklnkkkvklst

Timeline for d1yqaa1:

• d1yqaa1 first appeared in SCOP 1.73
  
• d1yqaa1 appears in SCOPe 2.05
  
• d1yqaa1 appears in SCOPe 2.07
  
• d1yqaa1 appears in the current release, SCOPe 2.08