![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.13: Linker histone H1/H5 [46827] (3 proteins) automatically mapped to Pfam PF00538 |
![]() | Protein Histone H1 homologue Hho1p [101037] (1 species) duplication: contains two similar globular domains |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries) |
![]() | Domain d1yqaa1: 1yqa A:171-257 [123875] |
PDB Entry: 1yqa (more details)
SCOPe Domain Sequences for d1yqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqaa1 a.4.5.13 (A:171-257) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kasspssltykemilksmpqlndgkgssrivlkkyvkdtypivgsasnfdylfnsaikkc vengelvqpkgpsgiiklnkkkvklst
Timeline for d1yqaa1: