SCOPe 2.07: Domain d1yq9a_: 1yq9 A:

Lineage for d1yq9a_ (1yq9 A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio gigas [TaxId:879] [186883] (1 PDB entry)

8. Domain d1yq9a_: 1yq9 A: [123873]
   Other proteins in same PDB: d1yq9h1, d1yq9i_
   automated match to d1frva_
   complexed with f3s, fco, gol, h2s, mg, ni, per, sf4

Details for d1yq9a_

PDB Entry: 1yq9, 2.35 Å

PDB Description: structure of the unready oxidized form of [nife] hydrogenase

PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d1yq9a_:

Sequence; same for both SEQRES and ATOM records:

>d1yq9a_ e.19.1.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

Timeline for d1yq9a_:

• d1yq9a_ first appeared in SCOP 1.73, called d1yq9a1
  
• d1yq9a_ appears in SCOPe 2.06
  
• d1yq9a_ appears in the current release, SCOPe 2.08