Lineage for d1yq9a1 (1yq9 A:4-264)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885149Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 885150Superfamily e.19.1: HydA/Nqo6-like [56770] (2 families) (S)
  5. 885151Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein)
  6. 885152Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 885160Species Desulfovibrio gigas [TaxId:879] [56773] (3 PDB entries)
  8. 885161Domain d1yq9a1: 1yq9 A:4-264 [123873]
    Other proteins in same PDB: d1yq9h1, d1yq9i1
    automatically matched to d2frva_
    complexed with f3s, fco, gol, h2s, mg, ni, per, sf4

Details for d1yq9a1

PDB Entry: 1yq9 (more details), 2.35 Å

PDB Description: structure of the unready oxidized form of [nife] hydrogenase
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOP Domain Sequences for d1yq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq9a1 e.19.1.1 (A:4-264) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOP Domain Coordinates for d1yq9a1:

Click to download the PDB-style file with coordinates for d1yq9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yq9a1: