![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
![]() | Protein automated matches [190110] (7 species) not a true protein |
![]() | Species Desulfovibrio gigas [TaxId:879] [186883] (1 PDB entry) |
![]() | Domain d1yq9a_: 1yq9 A: [123873] Other proteins in same PDB: d1yq9h1, d1yq9i_ automated match to d1frva_ complexed with f3s, fco, gol, h2s, mg, ni, per, sf4 |
PDB Entry: 1yq9 (more details), 2.35 Å
SCOPe Domain Sequences for d1yq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq9a_ e.19.1.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]} kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag hpciacsepnfwdlyspfysa
Timeline for d1yq9a_: