![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (2 species) |
![]() | Species Arthrobacter sp. c2-2 [TaxId:192168] [141778] (1 PDB entry) Uniprot Q8KRF6 313-609 |
![]() | Domain d1yq2f5: 1yq2 F:313-609 [123872] Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a3, d1yq2a4, d1yq2b1, d1yq2b2, d1yq2b3, d1yq2b4, d1yq2c1, d1yq2c2, d1yq2c3, d1yq2c4, d1yq2d1, d1yq2d2, d1yq2d3, d1yq2d4, d1yq2e1, d1yq2e2, d1yq2e3, d1yq2e4, d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f4 automated match to d1yq2a5 complexed with cl, mg, na, peg, so4 |
PDB Entry: 1yq2 (more details), 1.9 Å
SCOPe Domain Sequences for d1yq2f5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq2f5 c.1.8.3 (F:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} vrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvnairtshypp hprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmertverdknhp sivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmyssipetdsi grndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdkyprlhggfvw ewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglyefkqivs
Timeline for d1yq2f5:
![]() Domains from same chain: (mouse over for more information) d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f4 |