SCOP 1.73: Domain d1yq2e2: 1yq2 E:220-312

Lineage for d1yq2e2 (1yq2 E:220-312)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Arthrobacter sp. c2-2 [TaxId:192168] [141065] (1 PDB entry)

8. Domain d1yq2e2: 1yq2 E:220-312 [123864]
   Other proteins in same PDB: d1yq2a3, d1yq2a4, d1yq2a5, d1yq2b3, d1yq2b4, d1yq2b5, d1yq2c3, d1yq2c4, d1yq2c5, d1yq2d3, d1yq2d4, d1yq2d5, d1yq2e3, d1yq2e4, d1yq2e5, d1yq2f3, d1yq2f4, d1yq2f5
   automatically matched to 1YQ2 A:220-312
   complexed with cl, mg, na, peg, so4; mutant

Details for d1yq2e2

PDB Entry: 1yq2, 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)

PDB Compounds: (E:) beta-galactosidase

SCOP Domain Sequences for d1yq2e2:

Sequence; same for both SEQRES and ATOM records:

>d1yq2e2 b.1.4.1 (E:220-312) beta-Galactosidase, domains 2 and 4 {Arthrobacter sp. c2-2 [TaxId: 192168]}
ggitdawlrtgwsarsgagtgtidpeitadatafpvtlsvpelgvnvtwksaeevaplal
envepwsaevprlyeasvssaaesisvrlgfrt

Timeline for d1yq2e2:

• d1yq2e2 is new in SCOP 1.73
  
• d1yq2e2 appears in SCOP 1.75
  
• d1yq2e2 appears in the current release, SCOPe 2.08