Lineage for d1yq2e2 (1yq2 E:220-312)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. Species Arthrobacter sp. c2-2 [TaxId:192168] [141065] (1 PDB entry)
    Uniprot Q8KRF6 220-312! Uniprot Q8KRF6 610-721
  8. Domain d1yq2e2: 1yq2 E:220-312 [123864]
    Other proteins in same PDB: d1yq2a3, d1yq2a4, d1yq2a5, d1yq2b3, d1yq2b4, d1yq2b5, d1yq2c3, d1yq2c4, d1yq2c5, d1yq2d3, d1yq2d4, d1yq2d5, d1yq2e3, d1yq2e4, d1yq2e5, d1yq2f3, d1yq2f4, d1yq2f5
    automated match to d1yq2a2
    complexed with cl, mg, na, peg, so4

Details for d1yq2e2

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from Arthrobacter sp. C2-2 (isoenzyme C2-2-1)
PDB Compounds: (E:) beta-galactosidase

SCOPe Domain Sequences for d1yq2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2e2 b.1.4.1 (E:220-312) beta-Galactosidase, domains 2 and 4 {Arthrobacter sp. c2-2 [TaxId: 192168]}
ggitdawlrtgwsarsgagtgtidpeitadatafpvtlsvpelgvnvtwksaeevaplal
envepwsaevprlyeasvssaaesisvrlgfrt

SCOPe Domain Coordinates for d1yq2e2 are not available.

Timeline for d1yq2e2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yq2e1, d1yq2e3, d1yq2e4, d1yq2e5