Lineage for d1yq2e1 (1yq2 E:610-721)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762433Species Arthrobacter sp. c2-2 [TaxId:192168] [141065] (1 PDB entry)
    Uniprot Q8KRF6 220-312! Uniprot Q8KRF6 610-721
  8. 2762442Domain d1yq2e1: 1yq2 E:610-721 [123863]
    Other proteins in same PDB: d1yq2a3, d1yq2a4, d1yq2a5, d1yq2b3, d1yq2b4, d1yq2b5, d1yq2c3, d1yq2c4, d1yq2c5, d1yq2d3, d1yq2d4, d1yq2d5, d1yq2e3, d1yq2e4, d1yq2e5, d1yq2f3, d1yq2f4, d1yq2f5
    automated match to d1yq2a1
    complexed with cl, mg, na, peg, so4

Details for d1yq2e1

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)
PDB Compounds: (E:) beta-galactosidase

SCOPe Domain Sequences for d1yq2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2e1 b.1.4.1 (E:610-721) beta-Galactosidase, domains 2 and 4 {Arthrobacter sp. c2-2 [TaxId: 192168]}
pirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsdgplrag
esatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavp

SCOPe Domain Coordinates for d1yq2e1:

Click to download the PDB-style file with coordinates for d1yq2e1.
(The format of our PDB-style files is described here.)

Timeline for d1yq2e1: