Lineage for d1yq2d4 (1yq2 D:722-1023)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664502Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 664503Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 664504Species Arthrobacter sp. c2-2 [TaxId:192168] [141174] (1 PDB entry)
  8. 664508Domain d1yq2d4: 1yq2 D:722-1023 [123861]
    Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a3, d1yq2a5, d1yq2b1, d1yq2b2, d1yq2b3, d1yq2b5, d1yq2c1, d1yq2c2, d1yq2c3, d1yq2c5, d1yq2d1, d1yq2d2, d1yq2d3, d1yq2d5, d1yq2e1, d1yq2e2, d1yq2e3, d1yq2e5, d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f5
    automatically matched to 1YQ2 A:722-1023
    complexed with cl, mg, na, peg, so4; mutant

Details for d1yq2d4

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)
PDB Compounds: (D:) beta-galactosidase

SCOP Domain Sequences for d1yq2d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2d4 b.30.5.1 (D:722-1023) beta-Galactosidase, domain 5 {Arthrobacter sp. c2-2 [TaxId: 192168]}
trsprpatpldgalpvslgpatfdagtlvslagqpvsgprlelwraptdndrgagfgayg
pgdpwlnsgrgvpapsseavwkqagldrltrrvedvaalpdgirvrtryaaadsthsvav
eenwqldggelclriditpsagwnlvwprigvrwdlptdvdgaawfgagpresypdsmha
tmvarhaasleelnvpyarpqetghrsdvrwleldragapwlridaepdaagrrpgfsla
rhtaqeiaaaghphelptpshsylyvdaaqhglgsracgpdvwpdfalrpeartlklris
pa

SCOP Domain Coordinates for d1yq2d4:

Click to download the PDB-style file with coordinates for d1yq2d4.
(The format of our PDB-style files is described here.)

Timeline for d1yq2d4: