Lineage for d1yq2d1 (1yq2 D:610-721)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297861Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1297862Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1297863Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1297864Species Arthrobacter sp. c2-2 [TaxId:192168] [141065] (1 PDB entry)
    Uniprot Q8KRF6 220-312! Uniprot Q8KRF6 610-721
  8. 1297871Domain d1yq2d1: 1yq2 D:610-721 [123858]
    Other proteins in same PDB: d1yq2a3, d1yq2a4, d1yq2a5, d1yq2b3, d1yq2b4, d1yq2b5, d1yq2c3, d1yq2c4, d1yq2c5, d1yq2d3, d1yq2d4, d1yq2d5, d1yq2e3, d1yq2e4, d1yq2e5, d1yq2f3, d1yq2f4, d1yq2f5
    automated match to d1yq2a1
    complexed with cl, mg, na, peg, so4

Details for d1yq2d1

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from Arthrobacter sp. C2-2 (isoenzyme C2-2-1)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1yq2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2d1 b.1.4.1 (D:610-721) beta-Galactosidase, domains 2 and 4 {Arthrobacter sp. c2-2 [TaxId: 192168]}
pirlglslpaggkptlavanlrhtadasdvvlrwrvehdgavaasgevaaegsdgplrag
esatialpampaaplgetwltveavlrdatgwapaghplgavqldlsapavp

SCOPe Domain Coordinates for d1yq2d1:

Click to download the PDB-style file with coordinates for d1yq2d1.
(The format of our PDB-style files is described here.)

Timeline for d1yq2d1: