Lineage for d1yq2c5 (1yq2 C:313-609)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682674Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 682675Species Arthrobacter sp. c2-2 [TaxId:192168] [141778] (1 PDB entry)
  8. 682678Domain d1yq2c5: 1yq2 C:313-609 [123857]
    Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a3, d1yq2a4, d1yq2b1, d1yq2b2, d1yq2b3, d1yq2b4, d1yq2c1, d1yq2c2, d1yq2c3, d1yq2c4, d1yq2d1, d1yq2d2, d1yq2d3, d1yq2d4, d1yq2e1, d1yq2e2, d1yq2e3, d1yq2e4, d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f4
    automatically matched to 1YQ2 A:313-609
    complexed with cl, mg, na, peg, so4; mutant

Details for d1yq2c5

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)
PDB Compounds: (C:) beta-galactosidase

SCOP Domain Sequences for d1yq2c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2c5 c.1.8.3 (C:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]}
vrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvnairtshypp
hprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmertverdknhp
sivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmyssipetdsi
grndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdkyprlhggfvw
ewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglyefkqivs

SCOP Domain Coordinates for d1yq2c5:

Click to download the PDB-style file with coordinates for d1yq2c5.
(The format of our PDB-style files is described here.)

Timeline for d1yq2c5: