Lineage for d1yq2b3 (1yq2 B:4-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383920Species Arthrobacter sp. c2-2 [TaxId:192168] [141112] (1 PDB entry)
    Uniprot Q8KRF6 4-219
  8. 2383922Domain d1yq2b3: 1yq2 B:4-219 [123850]
    Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a4, d1yq2a5, d1yq2b1, d1yq2b2, d1yq2b4, d1yq2b5, d1yq2c1, d1yq2c2, d1yq2c4, d1yq2c5, d1yq2d1, d1yq2d2, d1yq2d4, d1yq2d5, d1yq2e1, d1yq2e2, d1yq2e4, d1yq2e5, d1yq2f1, d1yq2f2, d1yq2f4, d1yq2f5
    automated match to d1yq2a3
    complexed with cl, mg, na, peg, so4

Details for d1yq2b3

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1yq2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2b3 b.18.1.5 (B:4-219) beta-Galactosidase {Arthrobacter sp. c2-2 [TaxId: 192168]}
advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv
egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr
rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl
lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpa

SCOPe Domain Coordinates for d1yq2b3:

Click to download the PDB-style file with coordinates for d1yq2b3.
(The format of our PDB-style files is described here.)

Timeline for d1yq2b3: