SCOPe 2.05: Domain d1ypzc2: 1ypz C:1-180

Lineage for d1ypzc2 (1ypz C:1-180)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC homolog [54489] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries)

8. Domain d1ypzc2: 1ypz C:1-180 [123841]
   Other proteins in same PDB: d1ypza1, d1ypzb1, d1ypzc1, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2
   automatically matched to d1c16a2

Details for d1ypzc2

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (C:) H2-T22 protein

SCOPe Domain Sequences for d1ypzc2:

Sequence; same for both SEQRES and ATOM records:

>d1ypzc2 d.19.1.1 (C:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

Timeline for d1ypzc2:

• d1ypzc2 first appeared in SCOP 1.73
  
• d1ypzc2 appears in SCOPe 2.04
  
• d1ypzc2 appears in SCOPe 2.06
  
• d1ypzc2 appears in the current release, SCOPe 2.08