Lineage for d1ypzc2 (1ypz C:1-180)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406040Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 1406051Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries)
  8. 1406057Domain d1ypzc2: 1ypz C:1-180 [123841]
    Other proteins in same PDB: d1ypza1, d1ypzb1, d1ypzc1, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2
    automatically matched to d1c16a2

Details for d1ypzc2

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: immune receptor
PDB Compounds: (C:) H2-T22 protein

SCOPe Domain Sequences for d1ypzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypzc2 d.19.1.1 (C:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

SCOPe Domain Coordinates for d1ypzc2:

Click to download the PDB-style file with coordinates for d1ypzc2.
(The format of our PDB-style files is described here.)

Timeline for d1ypzc2: