| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC homolog [54489] (4 species) gamma, delta T-cell ligand |
| Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries) |
| Domain d1ypzc2: 1ypz C:1-180 [123841] Other proteins in same PDB: d1ypza1, d1ypzb1, d1ypzc1, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2 automatically matched to d1c16a2 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypzc2 d.19.1.1 (C:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll
Timeline for d1ypzc2: