![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
![]() | Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries) |
![]() | Domain d1ypza1: 1ypz A:181-276 [123837] Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2 automatically matched to d1c16a1 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypza1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt fqkwaavvvplgkeqsytchvyheglpeplilrwgg
Timeline for d1ypza1: