SCOPe 2.08: Domain d1ypqb_: 1ypq B:

Lineage for d1ypqb_ (1ypq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d1ypqb_: 1ypq B: [123834]
   Other proteins in same PDB: d1ypqa1
   automated match to d1hyra_
   complexed with dio

Details for d1ypqb_

PDB Entry: 1ypq, 1.4 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 Dioxane Complex

PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypqb_:

Sequence; same for both SEQRES and ATOM records:

>d1ypqb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
cilaafsicqkkanl

Timeline for d1ypqb_:

• d1ypqb_ first appeared in SCOP 1.73, called d1ypqb1
  
• d1ypqb_ appears in SCOPe 2.07