Lineage for d1yp7a1 (1yp7 A:1-157)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673734Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 673735Species Mouse (Mus musculus) [TaxId:10090] [50833] (18 PDB entries)
  8. 673746Domain d1yp7a1: 1yp7 A:1-157 [123823]
    automatically matched to 1YP6 A:1-157
    complexed with cd; mutant

Details for d1yp7a1

PDB Entry: 1yp7 (more details), 2 Å

PDB Description: van der waals interactions dominate hydrophobic association in a protein binding site occluded from solvent water
PDB Compounds: (A:) major urinary protein 1

SCOP Domain Sequences for d1yp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yp7a1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmglf
grepdlssdikerfaqlceehgilreniidlsnanrc

SCOP Domain Coordinates for d1yp7a1:

Click to download the PDB-style file with coordinates for d1yp7a1.
(The format of our PDB-style files is described here.)

Timeline for d1yp7a1: