SCOP 1.73: Domain d1yp4b1: 1yp4 B:317-451

Lineage for d1yp4b1 (1yp4 B:317-451)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain [141579] (1 species)

7. Species Potato (Solanum tuberosum) [TaxId:4113] [141580] (3 PDB entries)

8. Domain d1yp4b1: 1yp4 B:317-451 [123816]
   Other proteins in same PDB: d1yp4a2, d1yp4b2, d1yp4c2, d1yp4d2
   automatically matched to 1YP2 A:317-451
   complexed with adp, adq, so4

Details for d1yp4b1

PDB Entry: 1yp4, 2.3 Å

PDB Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ADP-glucose

PDB Compounds: (B:) Glucose-1-phosphate adenylyltransferase small subunit

SCOP Domain Sequences for d1yp4b1:

Sequence; same for both SEQRES and ATOM records:

>d1yp4b1 b.81.1.4 (B:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}
ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda
drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi
vtvikdalipsgiii

Timeline for d1yp4b1:

• d1yp4b1 is new in SCOP 1.73
  
• d1yp4b1 appears in SCOP 1.75
  
• d1yp4b1 appears in the current release, SCOPe 2.08