Lineage for d1yp4a2 (1yp4 A:11-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133256Protein Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain [142688] (1 species)
  7. 2133257Species Potato (Solanum tuberosum) [TaxId:4113] [142689] (3 PDB entries)
    Uniprot P23509 80-386
  8. 2133262Domain d1yp4a2: 1yp4 A:11-316 [123815]
    Other proteins in same PDB: d1yp4a1, d1yp4b1, d1yp4c1, d1yp4d1
    automated match to d1yp2a2
    complexed with adp, adq, so4

Details for d1yp4a2

PDB Entry: 1yp4 (more details), 2.3 Å

PDB Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ADP-glucose
PDB Compounds: (A:) Glucose-1-phosphate adenylyltransferase small subunit

SCOPe Domain Sequences for d1yp4a2:

Sequence, based on SEQRES records: (download)

>d1yp4a2 c.68.1.6 (A:11-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]}
tcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniski
yvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgtadavrqylwl
feehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideeg
riiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpg
andfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsap
iytqpr

Sequence, based on observed residues (ATOM records): (download)

>d1yp4a2 c.68.1.6 (A:11-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]}
tcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniski
yvltqfnsaslnrhlsrayagfvevlaaqqspenpdwfqgtadavrqylwlfeehtvley
lilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekp
qgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevi
pgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqpr

SCOPe Domain Coordinates for d1yp4a2:

Click to download the PDB-style file with coordinates for d1yp4a2.
(The format of our PDB-style files is described here.)

Timeline for d1yp4a2: