SCOPe 2.07: Domain d1yp3a1: 1yp3 A:317-451

Lineage for d1yp3a1 (1yp3 A:317-451)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain [141579] (1 species)

7. Species Potato (Solanum tuberosum) [TaxId:4113] [141580] (3 PDB entries)
   Uniprot P23509 387-521

8. Domain d1yp3a1: 1yp3 A:317-451 [123806]
   Other proteins in same PDB: d1yp3a2, d1yp3b2, d1yp3c2, d1yp3d2
   automated match to d1yp2a1
   complexed with atp, so4

Details for d1yp3a1

PDB Entry: 1yp3, 2.6 Å

PDB Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ATP

PDB Compounds: (A:) Glucose-1-phosphate adenylyltransferase small subunit

SCOPe Domain Sequences for d1yp3a1:

Sequence; same for both SEQRES and ATOM records:

>d1yp3a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}
ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda
drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi
vtvikdalipsgiii

Timeline for d1yp3a1:

• d1yp3a1 first appeared in SCOP 1.73
  
• d1yp3a1 appears in SCOPe 2.06
  
• d1yp3a1 appears in the current release, SCOPe 2.08