Lineage for d1yp3a1 (1yp3 A:317-451)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962682Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 962683Protein Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain [141579] (1 species)
  7. 962684Species Potato (Solanum tuberosum) [TaxId:4113] [141580] (3 PDB entries)
    Uniprot P23509 387-521
  8. 962693Domain d1yp3a1: 1yp3 A:317-451 [123806]
    Other proteins in same PDB: d1yp3a2, d1yp3b2, d1yp3c2, d1yp3d2
    automatically matched to 1YP2 A:317-451
    complexed with atp, so4

Details for d1yp3a1

PDB Entry: 1yp3 (more details), 2.6 Å

PDB Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ATP
PDB Compounds: (A:) Glucose-1-phosphate adenylyltransferase small subunit

SCOPe Domain Sequences for d1yp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yp3a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}
ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda
drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi
vtvikdalipsgiii

SCOPe Domain Coordinates for d1yp3a1:

Click to download the PDB-style file with coordinates for d1yp3a1.
(The format of our PDB-style files is described here.)

Timeline for d1yp3a1: