Class a: All alpha proteins [46456] (286 folds) |
Fold a.253: AF0941-like [140725] (1 superfamily) 6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix |
Superfamily a.253.1: AF0941-like [140726] (1 family) |
Family a.253.1.1: AF0941-like [140727] (1 protein) |
Protein Hypothetical protein AF0941 [140728] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry) Uniprot O29321 1-114 |
Domain d1yozb_: 1yoz B: [123797] automated match to d1yoza1 |
PDB Entry: 1yoz (more details), 2 Å
SCOPe Domain Sequences for d1yozb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yozb_ a.253.1.1 (B:) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]} ghmlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeev qrnfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev
Timeline for d1yozb_: