SCOP 1.73: Domain d1yozb1: 1yoz B:11-124

Lineage for d1yozb1 (1yoz B:11-124)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.253: AF0941-like [140725] (1 superfamily)
   6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix

4. Superfamily a.253.1: AF0941-like [140726] (1 family)

5. Family a.253.1.1: AF0941-like [140727] (1 protein)

6. Protein Hypothetical protein AF0941 [140728] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry)

8. Domain d1yozb1: 1yoz B:11-124 [123797]
   automatically matched to 1YOZ A:11-124

Details for d1yozb1

PDB Entry: 1yoz, 2 Å

PDB Description: predicted coding region af0941 from archaeoglobus fulgidus

PDB Compounds: (B:) Hypothetical protein AF0941

SCOP Domain Sequences for d1yozb1:

Sequence; same for both SEQRES and ATOM records:

>d1yozb1 a.253.1.1 (B:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

Timeline for d1yozb1:

• d1yozb1 is new in SCOP 1.73
  
• d1yozb1 appears in SCOP 1.75
  
• d1yozb1 appears in the current release, SCOPe 2.08, called d1yozb2