Lineage for d1yozb2 (1yoz B:11-124)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.253: AF0941-like [140725] (1 superfamily)
    6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix
  4. Superfamily a.253.1: AF0941-like [140726] (1 family) (S)
  5. Family a.253.1.1: AF0941-like [140727] (1 protein)
  6. Protein Hypothetical protein AF0941 [140728] (1 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry)
    Uniprot O29321 1-114
  8. Domain d1yozb2: 1yoz B:11-124 [123797]
    Other proteins in same PDB: d1yoza2, d1yozb3
    automated match to d1yoza1

Details for d1yozb2

PDB Entry: 1yoz (more details), 2 Å

PDB Description: predicted coding region af0941 from archaeoglobus fulgidus
PDB Compounds: (B:) Hypothetical protein AF0941

SCOPe Domain Sequences for d1yozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yozb2 a.253.1.1 (B:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

SCOPe Domain Coordinates for d1yozb2 are not available.

Timeline for d1yozb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yozb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1yoza1, d1yoza2