Lineage for d1yozb2 (1yoz B:11-124)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016134Fold a.253: AF0941-like [140725] (1 superfamily)
    6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix
  4. 2016135Superfamily a.253.1: AF0941-like [140726] (1 family) (S)
  5. 2016136Family a.253.1.1: AF0941-like [140727] (1 protein)
  6. 2016137Protein Hypothetical protein AF0941 [140728] (1 species)
  7. 2016138Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry)
    Uniprot O29321 1-114
  8. 2016140Domain d1yozb2: 1yoz B:11-124 [123797]
    Other proteins in same PDB: d1yoza2, d1yozb3
    automated match to d1yoza1

Details for d1yozb2

PDB Entry: 1yoz (more details), 2 Å

PDB Description: Predicted coding region AF0941 from Archaeoglobus fulgidus
PDB Compounds: (B:) Hypothetical protein AF0941

SCOPe Domain Sequences for d1yozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yozb2 a.253.1.1 (B:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

SCOPe Domain Coordinates for d1yozb2:

Click to download the PDB-style file with coordinates for d1yozb2.
(The format of our PDB-style files is described here.)

Timeline for d1yozb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yozb3