Lineage for d1yoza1 (1yoz A:11-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351349Fold a.253: AF0941-like [140725] (1 superfamily)
    6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix
  4. 2351350Superfamily a.253.1: AF0941-like [140726] (1 family) (S)
  5. 2351351Family a.253.1.1: AF0941-like [140727] (1 protein)
  6. 2351352Protein Hypothetical protein AF0941 [140728] (1 species)
  7. 2351353Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry)
    Uniprot O29321 1-114
  8. 2351354Domain d1yoza1: 1yoz A:11-124 [123796]
    Other proteins in same PDB: d1yoza2, d1yozb3

Details for d1yoza1

PDB Entry: 1yoz (more details), 2 Å

PDB Description: predicted coding region af0941 from archaeoglobus fulgidus
PDB Compounds: (A:) Hypothetical protein AF0941

SCOPe Domain Sequences for d1yoza1:

Sequence, based on SEQRES records: (download)

>d1yoza1 a.253.1.1 (A:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

Sequence, based on observed residues (ATOM records): (download)

>d1yoza1 a.253.1.1 (A:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgekkldpevineialyidrvekev

SCOPe Domain Coordinates for d1yoza1:

Click to download the PDB-style file with coordinates for d1yoza1.
(The format of our PDB-style files is described here.)

Timeline for d1yoza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yoza2