Lineage for d1yoza1 (1yoz A:11-124)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286738Fold a.253: AF0941-like [140725] (1 superfamily)
    6 helices, arranged into two interconnected 3-helical bundles; can also be described as a 'kinked' four-helical bundle; right-handed superhelix
  4. 1286739Superfamily a.253.1: AF0941-like [140726] (1 family) (S)
  5. 1286740Family a.253.1.1: AF0941-like [140727] (1 protein)
  6. 1286741Protein Hypothetical protein AF0941 [140728] (1 species)
  7. 1286742Species Archaeoglobus fulgidus [TaxId:2234] [140729] (1 PDB entry)
    Uniprot O29321 1-114
  8. 1286743Domain d1yoza1: 1yoz A:11-124 [123796]

Details for d1yoza1

PDB Entry: 1yoz (more details), 2 Å

PDB Description: predicted coding region af0941 from archaeoglobus fulgidus
PDB Compounds: (A:) Hypothetical protein AF0941

SCOPe Domain Sequences for d1yoza1:

Sequence, based on SEQRES records: (download)

>d1yoza1 a.253.1.1 (A:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

Sequence, based on observed residues (ATOM records): (download)

>d1yoza1 a.253.1.1 (A:11-124) Hypothetical protein AF0941 {Archaeoglobus fulgidus [TaxId: 2234]}
mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqr
nfyllktyvvsqlsihferlkefaeskgekkldpevineialyidrvekev

SCOPe Domain Coordinates for d1yoza1:

Click to download the PDB-style file with coordinates for d1yoza1.
(The format of our PDB-style files is described here.)

Timeline for d1yoza1: