SCOP 1.73: Domain d1yoxf1: 1yox F:5-242

Lineage for d1yoxf1 (1yox F:5-242)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins)
   duplication: there are three structural repeats per subunit; nine domains per ring-like trimer

6. Protein Hypothetical protein PA3696 [141645] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry)

8. Domain d1yoxf1: 1yox F:5-242 [123794]
   automatically matched to 1YOX A:5-244

Details for d1yoxf1

PDB Entry: 1yox, 2.3 Å

PDB Description: structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa

PDB Compounds: (F:) hypothetical protein PA3696

SCOP Domain Sequences for d1yoxf1:

Sequence, based on SEQRES records:

>d1yoxf1 b.82.5.2 (F:5-242) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsag
krklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaaygt
rvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaft
dgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfraree

Sequence, based on observed residues (ATOM records):

>d1yoxf1 b.82.5.2 (F:5-242) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvafa
apypgsvvavdlddvggrlfcqkdsflcaaygtrvgiafilqklegdglvfvhaggtlir
rqlngetlrvdtgclvaftdgidydvqlalllttlkgsgtvwlqslpfsrlagriydatf
raree

Timeline for d1yoxf1:

• d1yoxf1 is new in SCOP 1.73
  
• d1yoxf1 appears in SCOP 1.75
  
• d1yoxf1 appears in the current release, SCOPe 2.08, called d1yoxf_