SCOPe 2.06: Domain d1yoxd_: 1yox D:

Lineage for d1yoxd_ (1yox D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins)
   duplication: there are three structural repeats per subunit; nine domains per ring-like trimer
   automatically mapped to Pfam PF01987

6. Protein Hypothetical protein PA3696 [141645] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry)
   Uniprot Q9HXU4 5-244

8. Domain d1yoxd_: 1yox D: [123792]
   automated match to d1yoxa1

Details for d1yoxd_

PDB Entry: 1yox, 2.3 Å

PDB Description: structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa

PDB Compounds: (D:) hypothetical protein PA3696

SCOPe Domain Sequences for d1yoxd_:

Sequence, based on SEQRES records:

>d1yoxd_ b.82.5.2 (D:) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
asheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklw
sagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaa
ygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclv
aftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatf

Sequence, based on observed residues (ATOM records):

>d1yoxd_ b.82.5.2 (D:) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
asheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhv
afaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfilqk
legdglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglksmlfggegll
lttlkgsgtvwlqslpfsrlagriydatf

Timeline for d1yoxd_:

• d1yoxd_ first appeared in SCOP 1.73, called d1yoxd1
  
• d1yoxd_ appears in SCOPe 2.05
  
• d1yoxd_ is called d1yoxd2 in SCOPe 2.07
  
• d1yoxd_ appears in the current release, SCOPe 2.08, called d1yoxd2