Lineage for d1yoxc1 (1yox C:5-237)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677983Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 678156Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins)
    duplication: there are three structural repeats per subunit; nine domains per ring-like trimer
  6. 678157Protein Hypothetical protein PA3696 [141645] (1 species)
  7. 678158Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry)
  8. 678161Domain d1yoxc1: 1yox C:5-237 [123791]
    automatically matched to 1YOX A:5-244

Details for d1yoxc1

PDB Entry: 1yox (more details), 2.3 Å

PDB Description: structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa
PDB Compounds: (C:) hypothetical protein PA3696

SCOP Domain Sequences for d1yoxc1:

Sequence, based on SEQRES records: (download)

>d1yoxc1 b.82.5.2 (C:5-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsag
krklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaaygt
rvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaft
dgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatf

Sequence, based on observed residues (ATOM records): (download)

>d1yoxc1 b.82.5.2 (C:5-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvafa
apypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfilqkleg
dglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglllttlkgsgtvwlq
slpfsrlagriydatf

SCOP Domain Coordinates for d1yoxc1:

Click to download the PDB-style file with coordinates for d1yoxc1.
(The format of our PDB-style files is described here.)

Timeline for d1yoxc1: