Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins) the common fold is elaborated with additional (sub)domains |
Protein UBA3 [89764] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered) |
Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries) Uniprot Q8TBC4 33-458 |
Domain d1yovd_: 1yov D: [123788] Other proteins in same PDB: d1yova_, d1yovc_ automated match to d1ngvb_ complexed with zn |
PDB Entry: 1yov (more details), 2.6 Å
SCOPe Domain Sequences for d1yovd_:
Sequence, based on SEQRES records: (download)
>d1yovd_ c.111.1.2 (D:) UBA3 {Human (Homo sapiens) [TaxId: 9606]} hvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsgfrqihvi dmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqf hiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarvilpgmta ciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldgddpehiq wifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkiatsayipl nnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltnsaslqmks paitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttpqtvlf
>d1yovd_ c.111.1.2 (D:) UBA3 {Human (Homo sapiens) [TaxId: 9606]} hvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsgfrqihvi dmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqf hiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarvilpgmta ciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldgddpehiq wifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkiatsayipl nnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmkspaitnr tlylqstsievadvttpqtvlf
Timeline for d1yovd_: