SCOP 1.75: Domain d1yovc1: 1yov C:9-534

Lineage for d1yovc1 (1yov C:9-534)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
   the common fold is elaborated with additional (sub)domains

6. Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
   a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion

7. Species Human (Homo sapiens) [TaxId:9606] [89767] (8 PDB entries)
   Uniprot Q13564

8. Domain d1yovc1: 1yov C:9-534 [123787]
   Other proteins in same PDB: d1yovb1, d1yovd1
   automatically matched to d1ngva_
   complexed with zn

Details for d1yovc1

PDB Entry: 1yov, 2.6 Å

PDB Description: Insights into the Ubiquitin Transfer Cascade from the refined structure of the activating enzyme for NEDD8

PDB Compounds: (C:) amyloid protein-binding protein 1

SCOP Domain Sequences for d1yovc1:

Sequence; same for both SEQRES and ATOM records:

>d1yovc1 c.111.1.2 (C:9-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
keqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsge
dagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvva
tqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldkp
fpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdlir
qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila
ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi
gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm
lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa
ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Timeline for d1yovc1:

• d1yovc1 first appeared in SCOP 1.73
  
• d1yovc1 is called d1yovc_ in SCOPe 2.01
  
• d1yovc1 appears in the current release, SCOPe 2.08, called d1yovc_