![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
![]() | Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) ![]() transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
![]() | Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins) the common fold is elaborated with additional (sub)domains |
![]() | Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89767] (5 PDB entries) |
![]() | Domain d1yovc1: 1yov C:9-534 [123787] Other proteins in same PDB: d1yovb1, d1yovd1 automatically matched to d1ngva_ complexed with zn |
PDB Entry: 1yov (more details), 2.6 Å
SCOP Domain Sequences for d1yovc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yovc1 c.111.1.2 (C:9-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} keqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsge dagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvva tqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldkp fpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdlir qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
Timeline for d1yovc1: