Lineage for d1yovc1 (1yov C:9-534)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712649Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 712650Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 712657Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 712658Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion
  7. 712659Species Human (Homo sapiens) [TaxId:9606] [89767] (5 PDB entries)
  8. 712661Domain d1yovc1: 1yov C:9-534 [123787]
    Other proteins in same PDB: d1yovb1, d1yovd1
    automatically matched to d1ngva_
    complexed with zn

Details for d1yovc1

PDB Entry: 1yov (more details), 2.6 Å

PDB Description: Insights into the Ubiquitin Transfer Cascade from the refined structure of the activating enzyme for NEDD8
PDB Compounds: (C:) amyloid protein-binding protein 1

SCOP Domain Sequences for d1yovc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yovc1 c.111.1.2 (C:9-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
keqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsge
dagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvva
tqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldkp
fpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdlir
qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila
ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi
gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm
lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa
ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOP Domain Coordinates for d1yovc1:

Click to download the PDB-style file with coordinates for d1yovc1.
(The format of our PDB-style files is described here.)

Timeline for d1yovc1: