Lineage for d1yovb_ (1yov B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492228Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2492229Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2492236Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 2492268Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 2492269Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 2492271Domain d1yovb_: 1yov B: [123786]
    Other proteins in same PDB: d1yova_, d1yovc_
    automated match to d1ngvb_
    complexed with zn

Details for d1yovb_

PDB Entry: 1yov (more details), 2.6 Å

PDB Description: Insights into the Ubiquitin Transfer Cascade from the refined structure of the activating enzyme for NEDD8
PDB Compounds: (B:) ubiquitin-activating enzyme E1C

SCOPe Domain Sequences for d1yovb_:

Sequence, based on SEQRES records: (download)

>d1yovb_ c.111.1.2 (B:) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfk

Sequence, based on observed residues (ATOM records): (download)

>d1yovb_ c.111.1.2 (B:) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmk
spaitatrtlylqseertrpnllavadvttpqtvlfk

SCOPe Domain Coordinates for d1yovb_:

Click to download the PDB-style file with coordinates for d1yovb_.
(The format of our PDB-style files is described here.)

Timeline for d1yovb_: