Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
Protein Collagenase-3 (MMP-13) [55540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55541] (13 PDB entries) |
Domain d1youb1: 1you B:104-268 [123784] automatically matched to d1euba_ complexed with ca, pfd, so4, zn |
PDB Entry: 1you (more details), 2.3 Å
SCOP Domain Sequences for d1youb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1youb1 d.92.1.11 (B:104-268) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahe fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygp
Timeline for d1youb1: