Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.17: CSL zinc finger [144217] (2 families) |
Family g.41.17.1: CSL zinc finger [144218] (3 proteins) Pfam PF05207 |
Protein Diphthamide biosynthesis protein 3, DPH3 [144221] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144222] (2 PDB entries) Uniprot Q3E840 1-82! Uniprot Q3E840 2-82 |
Domain d1yopa1: 1yop A:3-83 [123782] complexed with zn |
PDB Entry: 1yop (more details)
SCOPe Domain Sequences for d1yopa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yopa1 g.41.17.1 (A:3-83) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdke dlaeyyeeagihppepiaaaa
Timeline for d1yopa1: