Lineage for d1yopa1 (1yop A:3-83)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263956Superfamily g.41.17: CSL zinc finger [144217] (2 families) (S)
  5. 2263957Family g.41.17.1: CSL zinc finger [144218] (3 proteins)
    Pfam PF05207
  6. 2263961Protein Diphthamide biosynthesis protein 3, DPH3 [144221] (1 species)
  7. 2263962Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144222] (2 PDB entries)
    Uniprot Q3E840 1-82! Uniprot Q3E840 2-82
  8. 2263964Domain d1yopa1: 1yop A:3-83 [123782]
    complexed with zn

Details for d1yopa1

PDB Entry: 1yop (more details)

PDB Description: the solution structure of kti11p
PDB Compounds: (A:) Kti11p

SCOPe Domain Sequences for d1yopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yopa1 g.41.17.1 (A:3-83) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdke
dlaeyyeeagihppepiaaaa

SCOPe Domain Coordinates for d1yopa1:

Click to download the PDB-style file with coordinates for d1yopa1.
(The format of our PDB-style files is described here.)

Timeline for d1yopa1: