Lineage for d1yopa1 (1yop A:3-83)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751357Superfamily g.41.17: CSL zinc finger [144217] (1 family) (S)
  5. 751358Family g.41.17.1: CSL zinc finger [144218] (2 proteins)
    Pfam PF05207
  6. 751362Protein Diphthamide biosynthesis protein 3, DPH3 [144221] (1 species)
  7. 751363Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144222] (2 PDB entries)
  8. 751365Domain d1yopa1: 1yop A:3-83 [123782]
    complexed with zn

Details for d1yopa1

PDB Entry: 1yop (more details)

PDB Description: the solution structure of kti11p
PDB Compounds: (A:) Kti11p

SCOP Domain Sequences for d1yopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yopa1 g.41.17.1 (A:3-83) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdke
dlaeyyeeagihppepiaaaa

SCOP Domain Coordinates for d1yopa1:

Click to download the PDB-style file with coordinates for d1yopa1.
(The format of our PDB-style files is described here.)

Timeline for d1yopa1: