Lineage for d1yona2 (1yon A:1-167)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688157Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 688246Protein Ketopantoate reductase PanE [69419] (1 species)
  7. 688247Species Escherichia coli [TaxId:562] [69420] (4 PDB entries)
  8. 688249Domain d1yona2: 1yon A:1-167 [123781]
    Other proteins in same PDB: d1yona1
    automatically matched to d1ks9a2
    complexed with apx

Details for d1yona2

PDB Entry: 1yon (more details), 1.95 Å

PDB Description: Escherichia coli ketopantoate reductase in complex with 2-monophosphoadenosine-5'-diphosphate
PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOP Domain Sequences for d1yona2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yona2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhn

SCOP Domain Coordinates for d1yona2:

Click to download the PDB-style file with coordinates for d1yona2.
(The format of our PDB-style files is described here.)

Timeline for d1yona2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yona1