![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein) |
![]() | Protein Ketopantoate reductase PanE [69085] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69086] (4 PDB entries) |
![]() | Domain d1yona1: 1yon A:168-291 [123780] Other proteins in same PDB: d1yona2 automatically matched to d1ks9a1 complexed with apx |
PDB Entry: 1yon (more details), 1.95 Å
SCOPe Domain Sequences for d1yona1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yona1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr kese
Timeline for d1yona1: