Lineage for d1yocb_ (1yoc B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902040Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1902060Protein Hypothetical protein PA1835 [143182] (1 species)
  7. 1902061Species Pseudomonas aeruginosa [TaxId:287] [143183] (1 PDB entry)
    Uniprot Q9I2R0 1-145
  8. 1902063Domain d1yocb_: 1yoc B: [123779]
    automated match to d1yoca1
    complexed with gol

Details for d1yocb_

PDB Entry: 1yoc (more details), 1.7 Å

PDB Description: Crystal Structure of genomics APC5556
PDB Compounds: (B:) hypothetical protein PA1835

SCOPe Domain Sequences for d1yocb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yocb_ d.38.1.5 (B:) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}
afmsqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigt
vhaialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatg
nlvvpvvayvddkpvfraeitmyvsqa

SCOPe Domain Coordinates for d1yocb_:

Click to download the PDB-style file with coordinates for d1yocb_.
(The format of our PDB-style files is described here.)

Timeline for d1yocb_: