Lineage for d1yocb1 (1yoc B:1-145)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721594Protein Hypothetical protein PA1835 [143182] (1 species)
  7. 721595Species Pseudomonas aeruginosa [TaxId:287] [143183] (1 PDB entry)
  8. 721597Domain d1yocb1: 1yoc B:1-145 [123779]
    automatically matched to 1YOC A:1-145
    complexed with gol

Details for d1yocb1

PDB Entry: 1yoc (more details), 1.7 Å

PDB Description: Crystal Structure of genomics APC5556
PDB Compounds: (B:) hypothetical protein PA1835

SCOP Domain Sequences for d1yocb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yocb1 d.38.1.5 (B:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}
msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvh
aialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnl
vvpvvayvddkpvfraeitmyvsqa

SCOP Domain Coordinates for d1yocb1:

Click to download the PDB-style file with coordinates for d1yocb1.
(The format of our PDB-style files is described here.)

Timeline for d1yocb1: