SCOP 1.75: Domain d1yoca1: 1yoc A:1-145

Lineage for d1yoca1 (1yoc A:1-145)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)

6. Protein Hypothetical protein PA1835 [143182] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143183] (1 PDB entry)
   Uniprot Q9I2R0 1-145

8. Domain d1yoca1: 1yoc A:1-145 [123778]
   complexed with gol

Details for d1yoca1

PDB Entry: 1yoc, 1.7 Å

PDB Description: Crystal Structure of genomics APC5556

PDB Compounds: (A:) hypothetical protein PA1835

SCOP Domain Sequences for d1yoca1:

Sequence; same for both SEQRES and ATOM records:

>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}
msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvh
aialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnl
vvpvvayvddkpvfraeitmyvsqa

Timeline for d1yoca1:

• d1yoca1 first appeared in SCOP 1.73
  
• d1yoca1 appears in SCOPe 2.01
  
• d1yoca1 appears in the current release, SCOPe 2.08