SCOPe 2.01: Domain d1yobb_: 1yob B:

Lineage for d1yobb_ (1yob B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (5 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [186881] (1 PDB entry)

8. Domain d1yobb_: 1yob B: [123777]
   Other proteins in same PDB: d1yoba1
   automated match to d1oboa_
   complexed with fmn, so4

Details for d1yobb_

PDB Entry: 1yob, 2.25 Å

PDB Description: c69a flavodoxin ii from azotobacter vinelandii

PDB Compounds: (B:) Flavodoxin 2

SCOPe Domain Sequences for d1yobb_:

Sequence; same for both SEQRES and ATOM records:

>d1yobb_ c.23.5.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

Timeline for d1yobb_:

• d1yobb_ first appeared in SCOP 1.73, called d1yobb1
  
• d1yobb_ was called d1yobb1 in SCOP 1.75
  
• d1yobb_ appears in SCOPe 2.02
  
• d1yobb_ appears in the current release, SCOPe 2.08