Lineage for d1yoaa1 (1yoa A:1-159)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403847Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2403875Protein Putative flavoprotein TTHA0420 [117234] (1 species)
  7. 2403876Species Thermus thermophilus [TaxId:274] [117235] (2 PDB entries)
    Uniprot Q5SL73
  8. 2403877Domain d1yoaa1: 1yoa A:1-159 [123775]
    complexed with fad, fmn

Details for d1yoaa1

PDB Entry: 1yoa (more details), 1.9 Å

PDB Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
PDB Compounds: (A:) putative flavoprotein

SCOPe Domain Sequences for d1yoaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yoaa1 b.45.1.2 (A:1-159) Putative flavoprotein TTHA0420 {Thermus thermophilus [TaxId: 274]}
mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
rhlypggdhslvvaevveagvrreekplvmwdtgwfygg

SCOPe Domain Coordinates for d1yoaa1:

Click to download the PDB-style file with coordinates for d1yoaa1.
(The format of our PDB-style files is described here.)

Timeline for d1yoaa1: