Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
Protein Putative flavoprotein TTHA0420 [117234] (1 species) |
Species Thermus thermophilus [TaxId:274] [117235] (2 PDB entries) Uniprot Q5SL73 |
Domain d1yoaa1: 1yoa A:1-159 [123775] complexed with fad, fmn |
PDB Entry: 1yoa (more details), 1.9 Å
SCOPe Domain Sequences for d1yoaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yoaa1 b.45.1.2 (A:1-159) Putative flavoprotein TTHA0420 {Thermus thermophilus [TaxId: 274]} mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev rhlypggdhslvvaevveagvrreekplvmwdtgwfygg
Timeline for d1yoaa1: